X
Email:
sales@ruixibiotech.com

VIP (human, mouse, rat) acetate salt,CAS: 40077-57-4

H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ acetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1243 5mg 426.00
- +
+ Add to cart

Product description

VIP, a 28-amino acid peptide belonging to the secretin-glucagon-CRF family, is widely distributed in the central and peripheral nervous systems. Acting both as a neurotransmitter and as a hormone, VIP is involved in a wide variety of biological activities, including vaso- and bronchodilation, smooth muscle relaxation, and stimulation of secretion. An injectable formulation of this peptide in combination with the adrenergic drug phentolamine is expected to provide a new and effective alternative for erectile dysfunction patients.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 40077-57-4
Sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Molecular Formula Aviptadil, VIP, human, porcine, rat, ovine
Molecular Formula  C₁₄₇H₂₃₈N₄₄O₄₂S
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product